PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000216G0990
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family M-type_MADS
Protein Properties Length: 63aa    MW: 7135.37 Da    PI: 11.0568
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000216G0990genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.42.8e-31959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+ rqvtf+kRrng+lKKA+ELSvLCdaeva+iifss+g+l+e+s+
  PH01000216G0990  9 KRIENKISRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGRLFEFST 59
                     79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.207161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.37E-30261IPR002100Transcription factor, MADS-box
CDDcd002651.57E-37261No hitNo description
PRINTSPR004047.0E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.5E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-333859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MGRGKVELKR IENKISRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSS RGRLFEFSTS  60
SW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-21162162Myocyte-specific enhancer factor 2B
1tqe_Q2e-21162162Myocyte-specific enhancer factor 2B
1tqe_R2e-21162162Myocyte-specific enhancer factor 2B
1tqe_S2e-21162162Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2371354e-97GU237135.1 Fargesia nitida MADS2 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002437883.11e-35hypothetical protein SORBIDRAFT_10g004390
RefseqXP_004964768.11e-35PREDICTED: MADS-box transcription factor 5-like
SwissprotQ0DEB83e-37MADS5_ORYSJ; MADS-box transcription factor 5
SwissprotA2Y9P03e-37MADS5_ORYSI; MADS-box transcription factor 5
TrEMBLM7Z2462e-37M7Z246_TRIUA; MADS-box transcription factor 1
STRINGSb10g004390.14e-35(Sorghum bicolor)
STRINGSi007226m5e-35(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.38e-35MIKC_MADS family protein